Query Sequence
>Pf6N2E2_687
MPFVNVRITRDGVTREQKAQVISEITETLQRVLGKDPHLTHIVIEEVDTDNWGYAGMTTTEYRSLPKE
Hit FamilyFIG00010453
Hit Family Function4-oxalocrotonate tautomerase (EC 5.3.2.-)


back to search