Query Sequence
>Pf6N2E2_610
MSQELRLIRRITLKLIPFLILLYLIAYVDRSAVGFAKLHMGADIGIGDAAYGLGAGLFFIGYFLLEIPSNLMLERYGARRWFARIMITWGAITIGMAFVQGPHSFYVMRFLLGAAEAGFFPGVLYYITQWFPVRHRGKILGLFILSQPIAMMITGPVSGGLLGMDGILGLHGWQWLFIVIGLPAVLLTWPVLRYLPDGPQQVKWMDQAEKDWLTGELKKDLQEYGQTRHGNPLHALKDKRVLLLALFYLPVTLSIYGLGLWLPTLIKQFGGSDLVTGFVSSVPYIFGIIGLLIIPRSSDRLNDRYGHLAVLYVLGAIGLFLSAWLSVPVLQLAALCLVAFALFSCTAVFWTLPGRFFAGASAAAGIALINSVGNLGGYIGPFVIGALKEYTGNLASGLYFLSCVMLFGLVLTGVVYRLLERKHVLPADQFAASARGATRT
Hit FamilyFIG00005529
Hit Family FunctionNitrate/nitrite transporter


back to search