Query Sequence
>Pf6N2E2_5983
MSINRQVRLGDFFSPESNEESMKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVVVSIGPTTAQEQLRTALALGADRAILVESAEDLTSLAVAKLLKAVVDKEQPSLVILGKQAIDSDNNQTGQMLAALSGYGQGTFASKVEVSGDSVAVTREIDGGAQTVSLKLPAIVTTDLRLNEPRYASLPNIMKAKKKPLEVLTPDALGVSTASTNKTLKVEAPAARSAGIKVKSVAELVEKLKNEAKVI
Hit FamilyFIG01304886
Hit Family FunctionElectron transfer flavoprotein, beta subunit


back to search