Query Sequence
>Pf6N2E2_5239
MSFSAPPLFAAWRQAWRAGYTLERLRGDLVAGLTVGIIAIPLAMALAIAVGVPPQHGLYTVLVAAPLIALTGGSRFNVSGPTAAFVVILLPITQQHGLGGLLLCTMLAGLILITLGLMRAGRLIQYIPYPVILGFTAGIGVVIATLQLKDLLGLTTVGQAKHYIEQLGELIVALPSARLGDGIIGVTCLAVLFAWPRWVPRVPGHLVALLVGALLGLALERGGWPVATLGERFSYMVDGISHPGIPPFLPSFEWPWNLPDGQGHPLTLSYDLIRQLLGPAFAIAMLGAIESLLCAVVADGMTGSKHDPNAELIGQGLGNLVAPLFGGITATAAIARSATNVRSGASSPLAAIIHSLVVLLAMVLLAPLFSYLPMAALAALLVIVAWNMSEAGHVLHTLRIAPRSDVLVLLTCLSLTVLFDMVMAVAVGLLLAAGLFIKRMSELTDSAELPRHFHQALLDMPEHVRCYAIRGPLFFGAAEKALDVLRKFDPGVRVVVVEMSAVPMLDMTALAAFENILKDYRKQGIGLILVATAPRVRLKLRRAGIHREQRQLAYVQTLEQARVKSEQWLASGSNAHPRLA
Hit FamilyFIG00004276
Hit Family FunctionPutative sulfate permease


back to search