Query Sequence
>Pf6N2E2_50
MSLFSAVELAPRDPILGLNEAFNADTRTNKVNLGVGVYCNEEGRIPLLRAVVEAETARVAQHVSRGYLPIDGIAAYDQAVQTLLFGKDSPLITSGRVITTQAVGGTGALKIGADFLKQLLPDAVVAISDPSWENHRALFETAGFPVQNYRYYDAATHDVNRSGLLEDLNALPDRSIVVLHACCHNPTGVDLSPEDWKNVLAVVKAKNHVPFLDMAYQGFGAGIDEDAAAVRLFAESGLTFFASSSFSKSFSLYGERVGALSIVSESKEESARVLSQVKRVIRTNYSNPPTHGASIVAAVLNSPELRAQWEAELAEMRLRIRGMRIQMVDMLAKAAPHHDFSFVARQSGMFSYSGLTVEQVTRLRNEFGIYALDTGRICVAALNQNNIDAVTKAIVQVI
Hit FamilyFIG01304780
Hit Family FunctionBiosynthetic Aromatic amino acid aminotransferase alpha (EC 2.6.1.57) @ Aromatic-amino-acid aminotransferase (EC 2.6.1.57)


back to search