Query Sequence
>Pf6N2E2_4836
MVKVGIVGGTGYTGVELLRLLAQHPQAEVVVITSRSEAGLAVADMYPNLRGHYDGLAFSVPDVKTLGACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRLQDADEWAKWYGQPHGAPDLLDEAVYGLPEVNREKIKQARLIAVPGCYPTATQLGFLPLLEAGLADASRLIADCKSGVSGAGRGASVGSLYSETSESMKAYAVKGHRHLPEIRQGLRRAAGKEVGLTFVPHLTPMIRGIHSTLYATVVDRSVDLQALFEKRYANEPFVDVMPAGSHPETRSVRGANVCRIAVHRPQDGDLVVVLSVIDNLVKGASGQAVQNLNILFGLDERLGLSHAGMLP
Hit FamilyFIG00000358
Hit Family FunctionN-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)


back to search