Query Sequence
>Pf6N2E2_460
MKIVIAPDSFKDSLSAQGVADAIAQGLAEVWPDAQLIKCPMADGGEGTVESVLAACHGEWRHTRVRGPLGVAVEARWGWLAESRTAIIEMAEASGLQLVPPGQRDACSSSTYGTGELIRAALDEGAGRVILAIGGSATNDAGAGAMQALGVVLLDNQGQPLPPGGLALVNLSHIDLSELDPRLARVSFEIAADVDNPLCGPHGASVVFGPQKGASASQVQALDRALGHFAERCARALNKDVRDEPGSGAAGGLGFAAKAFLGAQFRTGVDVVAQLTGLAEAVSGADLVITGEGRFDAQTLRGKTPFGVARIARQHGVPVVVIAGTLGEGYQALYEHGIDAAFALASGPMTLQQACTDAPRLLSERARDIARLWRVAHR
Hit FamilyFIG01320952
Hit Family FunctionGlycerate kinase (EC 2.7.1.31)


back to search