Query Sequence
>Pf6N2E2_4281
VAESRLQKIFGFRTRLYLTWAAMLVLFASFFLSFDLKFSIILDKLPNLLGVHLAPNGFLQGAVLTLFLCLCSIVASSLLGFITALARLSSSAVAFGIASFYASFFRGTPLLIQILLIYLGLPQLGVVPGAIAAGIIALSLNYGAYLSEIFRAGILGVPHGQREASLALGLSETVIFWRVTLPQAMRTIIPPTTNQFISMLKDSSLISVMGVWEVMFLAQSYGRSSYRYIEMLTTAAIIYWLMSIALELIQARMERHYGKAYLKRS
Hit FamilyFIG01322745
Hit Family FunctionAmino acid ABC transporter, permease protein


back to search