Query Sequence
>Pf6N2E2_4131
MAIPTRHSLFPFLSWLPRQTRASVGRDLVVGLSGAILALPQSIAYALIAGLPPEYGLYAAIVPVLIACLWGSSWHLICGPTAAISIVLYATVSPLAVPASQDYITLILLLTVLAGIFQWLLGLLRFGALVNFVSHSVVLGFTLGAAVVIALGQLPNLLGLDLPNEATALRGLLMLVSHIGAVDKPSLLLGLGTLVLGVVLKRLLPRWPSLLITLVISSLVVWLWPAMFGHVALVSAFAGRLPPFTPLPLDLELILRLLPGAVAVGMLGLVTSLSIARSLSVRSGQLLDANQEVRAQGLSNIVGGFFSGSLSAGSFTRSGLSYEAGACSPLAGVFSALWVALFAVAGANLIAHIPIPAMAGSILLIAWGLVDHRGIRALYRVSRAEFVVMGLTCLATLLLELQTAIYAGVLASLFFYLKRTSQPRVQHFREGEAEILRVGGSIFFGASHYLQARLQRLQAQRVVIDAQQINFIDYSGVEMLHQEARRLRSQGRSLTLRMARPQVVEELLKLEGAEHCPILFED
Hit FamilyFIG00005216
Hit Family FunctionSulfate permease


back to search