Query Sequence
>Pf6N2E2_4087
MNGSTYPAAQHVMVLYTGGTIGMQASAHGLAPASGFEARMRDYLHSQPELVVPQWRFREMSPLIDSANMTPAYWQQLREAVVDAVDVQGCDSVLILHGTDTLAYSAAAMSFQLLGLHARVCFTGSMLPAGVIDSDAWENLSGALVALGQGLAPGVHLYFHGELLAPTRCAKVRSFGRHPFKRLERQGGGLKASSLPAQLNYNQPKQLANIAALPLFPGISAEILDGLLGSGIQGLVLECYGSGTGPSDNPAFLASLERARDSGVVIVAVTQCHEGGVELDVYEAGSRLRGVGVLSGGGMTREAAFGKLQALIGAGLPVEEVRRLVELDLCGELA
Hit FamilyFIG00000376
Hit Family FunctionL-asparaginase (EC 3.5.1.1)


back to search