Query Sequence
>Pf6N2E2_3857
MMIDLYGFGPALAAGALMTVKLALTALCLGLVLGLLGALAKTSPYKPLQWLGGTYSTLVRGIPELLWVLLIYFGTVNLLRALGEYFGNPDLTLDAFAAGVIALGLCFGAYATEVFRGAILAIPKGHREAGVALGLSKWRIFTRLIMPQMWRIALPGLGNLFMILMKDTALVSVIGLEEIMRHAEIGVTVSKQPFTFYMVAAFMYLGLTVLAMIGMHLLERRAARGFTRSTQ
Hit FamilyFIG00002732
Hit Family FunctionArginine ABC transporter, permease protein ArtQ


back to search