Query Sequence
>Pf6N2E2_3589
MSIASVCVFCGASTGTDPAYREAAQALGRALAERKLTLVYGGGAVGLMGIVADAALAAGGEVIGIIPQSLKDKEIGHSGLTRLEVVDGMHARKARMAELSDAFIALPGGLGTLEELFEVWTWGQLGYHGKPLGLLEVNGFYSKLIGFLDHIVDEGFVRAPHRDMLQVSESAQSLLDALDEWQPSVQPKWAEQKPS
Hit FamilyFIG01349038
Hit Family FunctionLysine decarboxylase family


back to search