Query Sequence
>Pf6N2E2_3581
MPLREECLWEKLTPQRPENSGLTGEVTADVCVIGAGFTGLSAAVHLLEQGKRVVVLEAHRAGHGGSGRNVGLVNAGLWIPPDDIEAGFGEAVGSQLNRMLGAAPALVFSLIDKYNIDCQLRREGTLHMAHNARGEADLRSREEQWKRRGAPVELLTGQACVDATGTSKIAAALLDRRAGTLNPMAYTSGLAKAATDLGGQLFDHSPVTHLERQGQRWSVQTAQGAVLAEQVVIASNAYTEGDWTELRRNFFPGYYYQVASVPLTDEAARRILPGGQGSWDTRQVLSSIRRDKDGRLLLGSLGNGNRKPTWFLKAWADRVQQHYFPYLKSVEWECTWTGCIAFTPDHLMRLFEPAPGLVAVTGYNGRGVTTGTVVGKAFADYLCHGNAQALPIPFAPMQPLAGVGLRSCLYEAGFSLYHAGQCLRIVI
Hit FamilyFIG00005791
Hit Family FunctionL-pipecolate oxidase (1.5.3.7)


back to search