Query Sequence
>Pf6N2E2_3334
MSIQVEDYFARETFQKMKAFADKQETPFVVIDTAMIAQAYDDLRAGFEFAKVYYAVKANPAVEIIDLLKDKGSNFDIASIYELDKVMGRGVGPDQISYGNTIKKSRDIRYFYEKGVRLYATDSEADLRNIAKAAPGSKVYVRILTEGSTTADWPLSRKFGCQTDMAMDLLILARDLGLVPYGISFHVGSQQRDISVWDAAIAKVKVIFERLKEEDGIVLKLINMGGGFPANYITRTNSLETYAEEIIRFLKEDFGDDLPEIILEPGRSLIANAGILVSEVVLVARKSRTAVERWVYTDVGKFSGLIETMDEAIKFPIWTEKKGEMEEVVIAGPTCDSADIMYENYKYGLPLNLAIGDRLYWLSTGAYTTSYSAVEFNGFPPLKSFYV
Hit FamilyFIG01074451
Hit Family FunctionOrnithine decarboxylase (EC 4.1.1.17) / Arginine decarboxylase (EC 4.1.1.19)


back to search