Query Sequence
>Pf6N2E2_318
MDASQSATAADQGRRVFLKKSLVVSAAAAALGNLPGLAQAEPLSQRYPDPLINILDPSFMDLRIFNASVEKLATGLRWAEGPVWVGDGRYLLVSDIPNNRIVRWDEVTGGLSVYRENSNFSNGMCRDRQGRLLVCEGSTTASEGRRITRTEHNGTITVLADSFEGKPLNSPNDIVCKRDGSVWFTDPPFQTGNNYEGHKVTPAQPHAVYRIDGETGKVTRVIDDLAGPNGLCFSPDEKILYVVEGRAKPNRLIWAITVKDDGTLGERRKHIEGLDYAAIDGIKCDESGNLWCGWGGNGDPKADLEKLDGVRVFNPEGKAIGHISLPERCPNVCFGGREGNRLFMAGSHSLYSLFVNTRGATFA
Hit FamilyFIG00127296
Hit Family FunctionGluconolactonase (EC 3.1.1.17)


back to search