Query Sequence
>Pf6N2E2_3172
MRDLSTLPDLDIALVQTTLAWHDRRANLEHFEALLEQARGADLIILPEMFTTGFSMESETLAEPENGPTRQWLKALAAKLDAVITGSVIIQAADGSHRNRLLWARPDGEVLHYDKRHLFRMAGEHNHYTPGERQVLFELKGWRIRPLICYDLRFPVWSRDAEDTDLLLYTANWPGARRLHWNRLLPARAIENLCYVAAVNRVGTDGKGFAYTGDSQVLDFQGESLLSAGEADGVFKVCLNAADLAAYRTRFPANLDADRFEFTN
Hit FamilyFIG00638161
Hit Family FunctionAliphatic amidase AmiE (EC 3.5.1.4)


back to search