Query Sequence
>Pf6N2E2_273
MTLTSFGPANRIQRSAETHPLTWRLRDDGEAVWLDEYQAKNGYAAARKAFADMAGDDIVQTVKDSGLKGRGGAGFPTGVKWGLMPKDESINIRYLLCNADEMEPNTWKDRMLMEQLPHLLIEGMLISARALKTYRGYIFLRGEYTTAAKHLNRAVEEAKAAGLLGKNILGSGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPFPAAVGVWGKPTCVNNVETLCNVPAIIADGVDWYKSLARDGSEDMGTKLMGFSGKVKNPGLWELPFGVTGRELFEDYAGGMRDGYTLKCWQPGGAGTGFLLPEHLDAQMYAGGIAKVGTRMGTGLAMAVDNSVNMVSLLRNMEEFFSRESCGFCTPCRDGLPWSVKLLRALENGEGQAGDIETLLGLVGFLGPGKTFCAHAPGAVEPLGSAIKYFRPEFEAGIAPTSAVVPPLAKPIVVGA
Hit FamilyFIG00117890
Hit Family FunctionNADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)


back to search