Query Sequence
>Pf6N2E2_2630
MKQTQYVAREPDAQGFIHYTAEEHAVWNTLITRQLKVIEGRACQEYLDGIDKLGLPHDRIPQLDEINKVLGETTGWQVARVPALIPFQTFFELLASKQFPVATFIRTREELDYLQEPDIFHEIFGHCPLLTNPWFAEFTHTYGKLGLQASKEERVYLARLYWMTIEFGLVQTPQGRRIYGGGILSSPKETVYCLSDEPEHQAFDPLEAMRTPYRIDILQPVYFVLPELKRLFDLAHEDIMGMVKRGRELGLHAPKFPPKAA
Hit FamilyFIG00001792
Hit Family FunctionPhenylalanine-4-hydroxylase (EC 1.14.16.1)


back to search