Query Sequence
>Pf6N2E2_2102
MQALLNEILDAVRPLIGQGKVADYIPALGTVAPNQLGIAVYGNDGELYCAGDAETAFSVQSISKVFSLVQAIGHSGEAIWERLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDINQSRFAAPALSMRDFVRRLSGNPQVMVDGKVAESEYQHRARNAAMAYLMQSFGNFHNDVEAVLRSYFSHCALRMSCIDLARAFCFLANDGFCKHSGEQILSARQTQQVNSIMATSGLYDEAGNFAYRVGLPGKSGVGGGIVAVVPGRFTVCVWSPELNAAGNSLAGMAALELMSQRIGWSVF
Hit FamilyFIG00001174
Hit Family FunctionGlutaminase (EC 3.5.1.2)


back to search