Query Sequence
>Pf6N2E2_1939
MTPIGAEPDSLNAKRDTTKASRWVCRIFAIVLLMLGLALSIGGIILVADAGSAYYLITGLAFITSAVLLWRGDARGIWVYAAMLVWTTAWSLWEVGFNGWQLAPRLIGPFVLGAVLLLPHFTRLKPAPSTRKLPRGWPSFAGGLVAAIALGSVSHAFGPDAPDFPMLRRGVQSQAPAKLPEPLANNERTDWQAYGNDQGGTRFSPLADIDTTNVSKLVKVWEADMAPVNGDLNAIEGTPIMMGSSLYACDGNNGIHAFDAETGKELWRRDISNGVPQSGKPCRGVAYYKVPDANGFCSERIYAPSHNPTLVALDAKTGEYCPGFGNNGAVDLTKGVAPYPHGLFYVSSAPQVIRGKIVVGGGIPDGQYWGGPSGVIRAFDAVTGELAWAFDAGAPNRLGLPPEGQYYTPSTPNSWAPISADEKLGLVYLPVGNATPDAYGGQRRPYDEDISSAVIALDAETGRLRWKFQATHHDIWDYDVASQPTLLNWPTAKGMRPALIQPTKRGEIFVLDRETGEPIKAVEEQPVPQRDIAKGEWLSPTQPASVELPAFRGPQLREKDMWGATPIDQMVCRIMFKQSRYEGQFTPITLDKNVLIDPGSMGGVNWNGISLDVDRGLMIVNWTQVPDRIELVTREEATQRNFRIAPGLDAGGQAEQPMLDTPYGAYRVNFLSQLGIPCNAPPWGLIGAVDLVSGKLIWSKPFGSPRDIGPFGLPTLVSIPIGTPTAGGAVTTRGGLVFIGGAAEHTFRALDAATGRELWSSRLATSANATPMTYRSPVSGRQFVVVAEGGRPHYRTKPGSKLVAFAIPDSK
Hit FamilyFIG00124748
Hit Family FunctionGlucose dehydrogenase, PQQ-dependent (EC 1.1.5.2)


back to search