Query Sequence
>Pf6N2E2_1903
VNKTIKYLLPAGIVVAAGLGWFVNRTPFSPFANEASAPSADAQLVQRGEYVARLSDCVACHSTPKGAPFAGGLEMATPMGSIYATNITPDKQTGIGNYSLADFDRAVRSGVAADGHRLYPAMPYPSYAKLSDDDVRALYAFFMAGVKPAQQQNQQSHIPWPLNMRWPLALWNTAFVDDGAYQAKPSEDALWNRGAYIVQGAGHCGSCHTPRSLTMNEKSLDESSATFLSGSLLDGWYAPSLRQDPNTGLGRWSEQEIVDYLKTGRNAHSVVVGTMAEVFNNSTQYMSDPDLKAIAHYLVSLPGDPKRDGPPWKPAAKLAEQPLSTPGAANYMAKCSSCHGSDGSGQAPWIPPLAGASSSMVKEGATSINATLNGSERVVANGIPDSYRMPPYRNQLSDQEVADVLTFVRTSWGNQGGAVKADEVKELRERTNPASSNPIILQMR
Hit FamilyFIG01255231
Hit Family FunctionPutative diheme cytochrome c-553


back to search