Query Sequence
>Pf6N2E2_1799
MSQTQAERLQAERKLAENQFDITQYDHVPRRYYGRIFFATVIVIALIGLVRAFAEGKIEWSYIGQFLTSQAIMWGLLNTVVMAVLAMALGIVFGVITAIMRMSANPILRYVALIYTWLFRGTPLILQLLLWFNLALIFPTIGIPGLFEMDTVSLMTPFVAALLGLSINQGAYTAEVVRAGLLSVDTGQYEAAKSIGMPRLQALRRIILPQAMRIIIPPVGNEFIGMVKMTSLASVIQYSELLYNAQNIYYANARVMELLIVAGIWYLATVTVLSFGQSRLERRFARGAGKRS
Hit FamilyFIG00482249
Hit Family FunctionABC transporter permease protein


back to search