Query Sequence
>Pf6N2E2_1441
MQPIRLGLVGYGKIAQDQHVPAIHANPAFQLVAVATQGQPCAGVENFRSLGELLENGPQVDAIAFCTPPQGRFALVQQALAAGKHVLVEKPPCATLGEAMALVEQVREQGVSGLFAWHSRYAPGIAAARDWLASRTLHSVQIDWKEDVRKWHPGQAWIWQPGGLGVFDPGINALSIATHLLALPLFVEAAELRVPDNCQSPIAASIKMADARHLDIRAEFDFDHGHDELWSIEIRCAEGVLRLDNGGALLSIDGVRQAVSEEGEYAAVYRHFQQLINDKASDMDLQPLRLVADSFFVGSRTAVEPFYD
Hit FamilyFIG00731707
Hit Family FunctionUncharacterized oxidoreductase ydgJ (EC 1.-.-.-)


back to search