Query Sequence
>Pf6N2E2_1323
MSEDLDFSGQTVLVTGGAQGIGRAIVEAFALRGARVVIADLGLARAEAVADELTAEGCQVQAVGVDLADATAVFGMMAELEQRLGRLDILIHNAGYFPLTPFAEITPSMLDRTLAVNLSALFWLTQAALPMFRRQGQGCVLVTSSVTGPRVAYPGLSHYAASKAGVNGFIRNAALELAAENVRVNGVEPGMIATPAMANLGDDEVNQDIARRVPLGRLGQPSDIAGAMLYLASSLASYVTGQTLVVDGGSTLPEV
Hit FamilyFIG00621114
Hit Family Function3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)


back to search