Query Sequence
>Pf6N2E2_1103
MNMPRNAFKAALTSTQPQYGIWAGFATGYAAEIIAGTGYDWMLIDGEHAPNTVPSILGQLQAVAPYATAPVVRAVTGDANLIKQLLDVGAQTLMIPMVETAEQAQALVRAMRYPPHGIRGVGGGLTRATRWDGVANYLTTAHEELCLIVQVESRTGVENVEAIAAVEGVDAVFIGPADLSIGLGHAGNPGHPEVQERIRHAVDATLATGKACGILAPNEADARRYQAWGCQFIAVAIDISLLRQSAQATLARYREPATVQAPSRTY
Hit FamilyFIG00110223
Hit Family Function2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)


back to search