Query Sequence
>Pf6N2E2_106
MSKRKLIPLLIYILFLLVPIYWLLNMSFKSNTEILGSLTLWPQDFTFHNYKVIFTDPSWYTGYLNSLYYVSLNTVISLGVALPAAYAFSRYRFLGDKHLFFWLLTNRMAPPAVFLLPFFQLYSSIGLFDTHIAVALAHCLFNVPLAVWILEGFMSGVPKEIDETAYIDGYSFPKFFAKIFIPLIGSGIGVTAFFCFMFSWVELLLARTLTSVNAKPIAAVMTRTVSASGIDWGVLAAAGVLTILPGMLVIWFVRNHVAKGFALGRV
Hit FamilyNo hits found for this sequence


back to search