Query Sequence
>Pf1N1B4_915
MTTHTFKPDMPPPSSSIGVVAWMRAHMFSSWINTLLTLFAFYLIYLIVPPVVSWAILDANWVGTTRADCTKEGACWVFIQQRFGQFMYGYYPTDLRWRVDLTVWLAVIGVAPLFIARVPHKAIYGLSFLVLYPIISYVLLHGGWFGLTEVATSQWGGLMLTLVIATVGIVGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNFDKLLRALIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLGMATEGYVFAALVFWIFCFGMSRYSMHLERKLDTGHKR
Hit FamilyFIG00058860
Hit Family FunctionGlutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)


back to search