Query Sequence
>Pf1N1B4_5798
MTHSIAFNFEDGVTRFIDANAGETVADAAYRQGINIPLDCRDGACGTCKCFAEAGRYDLGEDYIEDALSADEAQQGFVLTCQMRAQSDCVVRVPVSSDVCRTRQASYDATISAVRQLSDSTIALSIKGESLSKLAFLPGQYVNLGVPGSEQTRAYSFSSLQRDGEVSFLIRNVPGGLMSSFLTGMAKAGDSMSLAGPLGSFYLRDIRRPLLLLAGGTGLAPFTAMLEKIAEQGSEHPLHLIYGVTNDFDLVELDRLEAFAARIANFSFSACVANPDSRHPLKGYVTQHIEPRHLNEGDVDVYLCGPPPMVEAVSQFIRDQGIAPANFYYEKFAASAA
Hit FamilyFIG00143043
Hit Family Function2-chlorobenzoate 1,2-dioxygenase reductase component


back to search