Query Sequence
>Pf1N1B4_572
MLTHRNLVANMLQCKALMGSNLNEGCEILITPLPLYHIYAFTFHCMAMMLIGNHNILISNPRDLTAMVKELSKWKFSGFVGLNTLFVALCNNEAFRKLDFSSLKITLSGGMALQLAAAERWKEVAGCPICEGYGMTETSPVATVNPSQNIQIGTIGIPVPSTLCKVIDDAGVEQPLGAIGELCVKGPQVMKGYWQRQDATDEILDSEGWLKTGDIALIQPDGYMRIVDRKKDMILVSGFNVYPNELEDVLATLPGVLQCAAIGVPDEKSGEAIKIFIVAKPGVTLTKDQVMEHMRANVTGYKVPKAVEFRDALPTTNVGKILRRELRDEELKKLGVKKVSA
Hit FamilyFIG01966468
Hit Family FunctionLong-chain-fatty-acid--CoA ligase (EC 6.2.1.3)


back to search