Query Sequence
>Pf1N1B4_5639
MYSAKNTAAVEKGFAHTGANLVRDVSLPALVLHRDALEHNIRWMQDFVSNSGAELAPHGKTSMTPALFRRQLDAGAWGITLASATQTRAAYAHGVHRVLMANQLVGTPNMALIADLLADPTFDFYCMVDHPDNVADLGAYFASRGVRLNVMIEYGVVGGRCGCRTETEVLALAKAIAAQPALALTGIEGYEGVIHGDHAVSGIRAFADSLVRLAVQLQDSGAFAIAKPIITASGSAWYDLIAESFEAQNACGRFLSVLRPGSYVAHDHGIYKEAQCCVLDRRSDLHEGLRPALEVWAHVQSLPEPGFAVIALGKRDVAYDAGLPVPLLRYKAGVVPAIGEDVGACKVTAVMDQHAFMTVAPGVELRVGDIISFGTSHPCLTFDKWRIGCLVDEQLNVIETMETCF
Hit FamilyFIG01432728
Hit Family FunctionD-serine deaminase (EC 4.3.1.18)


back to search