Query Sequence
>Pf1N1B4_562 Histidine transporter, periplasmic histidine-binding protein
MRSIKTLLGSSLLALSLVAGHVPAAEKTTPIHFGDITWESGSLITEILRLIVEKGYGYPTDTLPGSTVSLEAALAKNDIQVIGEEWAGRSPAWVKAASEGKVFGLGDTVKGATEGWWVPEYVIKGDPERGIKPLAPELKSVADLARYKDVFRDPEDPSRGRFLNSPTGWTSEIVNSQKLKAYDLTASYVNFRTGSGAALDAEVASSIRRGKPVLFYYWSPTPLLGRFKLVKLEEPPFDAQAWKTLADANNPNPKGTRSMPASLAIGVSAPFKAQYPDLVAFFEKVDLPIDLLNQTLGQMSEKRQPPRQVAEAFLRDQPQVWKAWVPGEVATKVSESL
Hit FamilyFIG00956848
Hit Family Function


back to search