Query Sequence
>Pf1N1B4_562
MRSIKTLLGSSLLALSLVAGHVPAAEKTTPIHFGDITWESGSLITEILRLIVEKGYGYPTDTLPGSTVSLEAALAKNDIQVIGEEWAGRSPAWVKAASEGKVFGLGDTVKGATEGWWVPEYVIKGDPERGIKPLAPELKSVADLARYKDVFRDPEDPSRGRFLNSPTGWTSEIVNSQKLKAYDLTASYVNFRTGSGAALDAEVASSIRRGKPVLFYYWSPTPLLGRFKLVKLEEPPFDAQAWKTLADANNPNPKGTRSMPASLAIGVSAPFKAQYPDLVAFFEKVDLPIDLLNQTLGQMSEKRQPPRQVAEAFLRDQPQVWKAWVPGEVATKVSESL
Hit FamilyFIG00956848
Hit Family FunctionHistidine transporter, periplasmic histidine-binding protein


back to search