Query Sequence
>Pf1N1B4_561
MKLYYAPQACSLAPHIVLRELDLPFELVRVDNSTKQTATGEDFLAINPKGYVAALQLDNGDVLTEGPAILQYLADLRPEASLAAENGTFERVRLQEWLNFVSTEIHGGLGWLFNSQFSDDVKALIKEKLFKRFVVLSQTLEGQDYLMASGFGIADAYLFTVLRWTQVFGIDLDQWPTLARFQVRINQRTSVKAALAAELP
Hit FamilyFIG00004065
Hit Family FunctionGlutathione S-transferase (EC 2.5.1.18)


back to search