Query Sequence
>Pf1N1B4_5134
MNLQNIGVIGAGTMGNGIAQVCALAGFHVTLIDISESALQKAIATVDKNLDRQVAKNTLAHEQKLAALDKIRTSTDYNSLQNVQMVIEAATENLDLKLRVLQQIAAQVSADCVIASNTSSLSITQLAASVSQPERFIGLHFFNPVPVMGLIEVIRGLQTSDATHALALDMATTLGKTAITAGNRPGFVVNRILVPMINEAILVFQEGLASVDDIDAGMRLGCNQPIGPLALADLIGLDTVLAILEAFYDGFNDSKYRPAPLLKEMVAAGYLGRKTGRGFHAYA
Hit FamilyFIG00068115
Hit Family Function3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)


back to search