Query Sequence
>Pf1N1B4_5103
MSSQATTVPRLNLRLGLRNPRLAMGLGLTILFGWLVLAIFAPWIAPFDPIAQNTDIRLVAPHLAHPFGTDNFGRDVLSRVIWSARIDLQLAVIGVIFPFLIGTCVGALSGYIGGRFDTFCMRLIDIILAFPFLVLMLAIMAILGPGLMSFYIAMALVGWVSYARLIRSQILILKESDFALAAKSLGFGHGRILFRHLLPNAMFGSIVFSMSDAVLVLLNGAAVSYLGLGVQPPTAEWGTMVAEGQSFITSAWWICTFPGLAIVTLAMGFSLLADAVAEHLGERS
Hit FamilyFIG00006691
Hit Family FunctionDipeptide transport system permease protein DppC (TC 3.A.1.5.2)


back to search