Query Sequence
>Pf1N1B4_4844
MYLVCGEALFDFFSEDDASGLASKVNFKAIAGGSPFNVAVGLRRLGVDAALFGGLSTDYLGRRLQQVLQDEGVRPDYLVDFAAPTTLAMVAVGANGSPHYSFRGEGCADRQLSLAHLPELGPEVRGLHVGSFSLVVQPIADTLLALVQRESGKRLISLDPNVRLNPEPNIELWRSRIAKLVELADLIKVSDEDLSLLYPEQDPQRVIEGWLEHRCQLVFLTRGGEGATVFSRAHGTWSVPACSVKIADTVGAGDTFQAALITWLTEQQLDSVEGLQQLSREQIDAMLRFAVSAAALTCSKTGPDLPYRRQLS
Hit FamilyFIG00001653
Hit Family FunctionFructokinase (EC 2.7.1.4)


back to search