Query Sequence
>Pf1N1B4_4805
MSQTQAERLQAERKLAENQFDITQYQHVPRRYYGRIFFATVIVIAIVGLVRAFAEGKIEWSYIGQFLTSQAIMWGLLNTIVMAVLAMALGIVFGVITAIMRMSANPILRYVALTYTWLFRGTPLILQLLLWFNLALIFPTIGIPGLFEMDTVSLMTPFAAALLGLSINQGAYTAEVVRAGLLSVDTGQYEAAKSIGMPRLQALRRIILPQAMRIIIPPVGNEFIGMVKMTSLASVIQYSELLYNAQNIYYANARVMELLIVAGIWYLATVTVLSFGQSRLERRFARGAGKRS
Hit FamilyFIG00482249
Hit Family FunctionABC transporter permease protein


back to search