Query Sequence
>Pf1N1B4_4123
MEVINQLQPAECEGMEDIRREIDALDHAVIKLLGKRFQYVLAASKFKTSATSVRAPERFKAMLATRREWAETEGLSPDAIEKMYSDLVNHFIAEEMKHWAAHQSEN
Hit FamilyFIG00059862
Hit Family FunctionIsochorismate pyruvate-lyase (EC 4.-.-.-)


back to search