Query Sequence
>Pf1N1B4_4098
MMFLQFFIWGGWFVTLGTFLSSNLGASGGQIGMAFSTQSWGAIIAPFVIGLIADRYFNAERILAVLHLIGAVLLLQLYRAPDFSAFYPFVLAYMMIYMPTLALVNSVAFRQMRDPALEFSRIRVWGTIGWIVAGVVISFVFAWDSQQAISSGGLRNTFLMSAIASFVLGIYSFSLPRTAPLKPEPGSVGLKQMLGLDALGLLKDRSYLVFFIASILICIPLAFYYQNANPFLAEIGVTNPTAKMAIGQVSEVLFMLLLPLFIQRFGIKIALLVGMLAWALRYLLFAYGNNGDLAFMLFTGIALHGICYDFFFVSGQIYTDAKASERFRSSAQGLITLATYGLGMLIGFWVAGAVTDHYASADSHDWKSIWLFPAGFALAIFFCFSLAFKGRQSVAAPSSI
Hit FamilyFIG00004622
Hit Family FunctionPutative nucleoside transporter YegT


back to search