Query Sequence
>Pf1N1B4_3813
VEIACLDLEGVLVPEIWIAFAEKTGIDSLRATTRDIPDYDVLMKQRLRILDEHGLKLSDIQEVIATLKPLEGASEFVDWLRERFQVVILSDTFYEFSQPLMRQLGFPTLLCHRLITDDAGRVTGYQLRQKDPKRQSVLAFKSLYYRVIAAGDSYNDTTMLGEADAGILFHAPDNVIREFPQFPAVHSFAELKQEFIKASNRALSL
Hit FamilyFIG00000582
Hit Family FunctionHomoserine kinase (EC 2.7.1.39)


back to search