Query Sequence
>Pf1N1B4_3808
MNAPLDEFGPIKAVIFDMDGLLLDTEGIYTEVTSIIAGRYGRTFDWSVKQNIIGRGAGDLARYVVEALDLPITAEEFLVIREPLMRERFPTALAMPGAEELVRHLKANNIPIAVGTSSSRQSFGEKTTLHREWFALFDFIVTADDPEVGAAKPAPDIFLTAARRLGVAPGDCLVFEDSPFGVTAAKAAGMTAIAIPDAAMADEKYAHADGILRTLKAFKPGACGLPALEWA
Hit FamilyFIG00672005
Hit Family Functionhydrolase, haloacid dehalogenase-like family


back to search