Query Sequence
>Pf1N1B4_3686
MKVLKGQDILALGFMTFALFVGAGNIIFPPIVGLQSGPNVWMAALGFLITAVGLPVITVVALAKVGGAMDALSSPIGKVAGGLLAAACYLAVGPLFATPRTATVSFEVGLAPLTGESPLALFLYSSVYFLVVFFISLYPGRLLDTVGRFLAPLKIIALAVLGIAAFALPAGDIGVATPEYVAAPFSQGFINGYLTMDTLGALVFGIVIVNAIRSRGVESPALITRYAIIAGLIAGVGLALVYVSLFRLGSGSHEVAAGAANGAAVLHAYVQHTFGSLGSGFLAVLISLACLVTAVGLTCACAEYFSRVLPLSYKTLVIILAAFSLLVSNLGLTKLIAFSIPVLTAIYPPCIALVALSFCKDFWHEQGRIVGPVMLVSFIFGLIDALKGAGLADWMPTQLAHLPLSEQGLAWLVPSVMTLVVAVVCDRLLGKREEALA
Hit FamilyFIG00905542
Hit Family FunctionBranched-chain amino acid transport system carrier protein


back to search