Query Sequence
>Pf1N1B4_351
VLFLQGGASQQFAQIPLNLLPESGTADYIDTGIWSQKAIEEASRYGHVNVAATAKPYDYFAIPGQNEWKLSKDAAYVHYAPNETIGGLEFQWIPETGDVPLVADMSSDILSRPVDVSRFGMIYAGAQKNIGPSGIVVNIVREDLLGHARSICPTMLNYKVAADNGSMYNTPPTLAWYLSGLVFEWLKEQGGVEAIGKLNEVKQRTLYDFIDASGLYSNPINKSDRSWMNVPFRLADDRLDKPFLAGADERGLLNLKGHRSVGGMRASIYNAVDIVAVNALVSYMAEFEKEHG
Hit FamilyFIG00000445
Hit Family FunctionPhosphoserine aminotransferase (EC 2.6.1.52)


back to search