Query Sequence
>Pf1N1B4_3332
MIAGSMVALVTPMDAQGRLDWDSLSKLVDFHLQEGTNAIVAVGTTGESATLDVNEHIEVIRRVVAQVAGRIPVIAGTGANSTREAIELTTNAKNAGADACLLVTPYYNKPTQEGLYQHFKAIAEAVDIPQILYNVPGRTACDMQAETVIRLSTVKNIIGIKEATGDLQRAKDILAGVSSDFLVYSGDDATAVELMLLGGKGNISVTANVAPRAMSELCAAAMAGDAVKARAIHEKLMPLNKTLFIESNPIPVKWALHEMGLMPDGIRLPLTWLSAACHEPLRQAMRQSGVLV
Hit FamilyFIG00019600
Hit Family Function4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)


back to search