Query Sequence
>Pf1N1B4_2879
MRHIISLLLENEPGALSRVVGLFSQRNYNIESLTVAPTEDPTLSRLTLTTVGHDEVIEQITKNLNKLIEVVKLVDLSESAHIERELMLVKVKATGAQRAEIKRTTDIYRGQIVDVSASVYTVQLTGTSDKLDSFIQSIGTASILETVRSGVTGIARGDKVLSI
Hit FamilyFIG00000433
Hit Family FunctionAcetolactate synthase small subunit (EC 2.2.1.6)


back to search