Query Sequence
>Pf1N1B4_2777
MLRWCSRSIFLQVVLGLVLGIVCGLTLPEYSAQLKPLGDGFIKLIKMLIGLIVFCVVVSGISGAGDLKKVGRIGLKSVIYFEILTTIALVIGLVFAFTTGIGSGANIHLEQLSAADMGDIAQRGQHMQTTSQFLMNLIPTSVIGAFAENNILQVLLFSVLFGSALNLVGEAASGISRLINELSHVIFRIMGMIVRLAPIGVFGAIAFTTSKYGLDSLQHLGSLVGLFYMTCVAFVALILGLVMRLSGLKMWPLLKYLREELLIVMGTASSDAVLPQIMRKLEHLGIGSSTVGLVIPTGYSFNLDGFSIYLTLAIVFIANATGTPLAMTDLLTILLVSLITSKGAHGIPGSALVILAATLTAIPAIPVVGLVLVLAVDWFMGIGRALTNLIGNCVATVAIARWEKDIDIQRANKVLSGQVGYTFQPRKPVVPAHQQEF
Hit FamilyFIG01349419
Hit Family Functionprobable dicarboxylate transporter


back to search