Query Sequence
>Pf1N1B4_2282
MRLALFDLDNTLLGGDSDHAWGDYLCERGFLDAVAYKARNDEFYQDYLAGKLDNDAYLNFCLEVLGRTEMATLDQWHLDYMRDCIEPIVLPKGIELLAKHREAGDKLVIITATNRFVTGPIATRLGVETLIATECEMIDGRYTGRSTDVPCFREGKVTRLNRWLDETGHNLEDSYFYSDSMNDLSLLEQVANPIAVDPDPNLRAEAEKRGWPVISLRD
Hit FamilyFIG00000149
Hit Family FunctionPhosphoserine phosphatase (EC 3.1.3.3)


back to search