Query Sequence
>Pf1N1B4_1774
MKIAVLSRNPRLYSTRRLVEAGIERGHEMVVIDTLRAYMNIASHKPQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVFPLNESVAIARSRDKLRSLQLLSRRGIGLPVTGFAHSPDDIPDLIEMVNGAPLVIKVLEGTQGIGVVLCETATAAESVIEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIAAMKRQAKPGEFRSNLHRGGSASLIKITPEERMTALRAAKVMGLAVAGVDILRSNHGPLVMEVNSSPGLEGIETTTGKNVAGIIIEHLEKNGGPNMTRTKGKG
Hit FamilyFIG00001180
Hit Family FunctionRibosomal protein S6 glutaminyl transferase


back to search