Query Sequence
>Pf1N1B4_1703
MWFDRLLQGFIDTFLMVGVSSLIALLAGIPLAVILVTSSKGGIYAAPALNRALGAFVNLFRSIPFLILMVALIPFTRLIVGTTYGVWAAVVPLTIAATPFFARIAEVSLREVDHGLIEAAQAMGCRRWHIVWHVLLPEALPGIVGGFTITLVTMINSSAMAGAIGAGGLGDIAYRYGYQRFDSQIMLTVIVLLVVLVAVIQLGGDRLARGLNKR
Hit FamilyFIG00045144
Hit Family FunctionMethionine ABC transporter permease protein


back to search