Query Sequence
>Pf1N1B4_1346
MRITATAEFMLEPAFFPVEPNKDAGSSRDAIGLGQRVGPGLNTRHGTILTLEDISVSFDGFKALNDLNLYIGVGELRCIIGPNGAGKTTLMDVITGKTRPSHGKAWFGETLDLTQMSEVQIAQAGIGRKFQKPTVFEALSVFENLELAQKTDKSVWASLRARLSGEQKDRISEVLETIRLTASVNRPAGMLSHGQKQFLEIGMLLMQDPQLLLLDEPVAGMTDAETEFTAELFKSLAGKHSLMVVEHDMGFVGSIADHVTVLHQGSVLAEGSLEQVQDNERVIEVYLGR
Hit FamilyFIG00027526
Hit Family FunctionUrea ABC transporter, ATPase protein UrtD


back to search